Skip to content

VIP vs Prostacyclin

Vasoactive intestinal peptide (VIP) and prostacyclin (PGI₂) are both potent vasodilators that signal through cyclic adenosine monophosphate (cAMP) elevation. Despite sharing this downstream signaling mechanism, they differ in receptor pharmacology, tissue distribution, and clinical applications. VIP is a neuropeptide with broad tissue effects; prostacyclin is an eicosanoid with primary vascular and platelet functions. Understanding their distinctions informs rational vasodilator selection.

VIP is a 28-amino acid neuropeptide belonging to the secretin/glucagon superfamily:

  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ (28 amino acids)
  • Molecular weight: ~3,326 Da
  • Receptors: VPAC1 and VPAC2 (Gs-coupled)
  • Signaling: Gs → adenylyl cyclase → cAMP → PKA
  • Half-life: ~1–2 minutes (native); longer with analogs
  • Source: Neural (NANC neurons, enteric nervous system)

Prostacyclin (PGI₂) is an eicosanoid derived from arachidonic acid:

  • Structure: Bicyclic eicosanoid with enol ether linkage
  • Molecular weight: ~352 Da
  • Receptors: IP receptor (Gs-coupled)
  • Signaling: Gs → adenylyl cyclase → cAMP → PKA
  • Half-life: ~2–3 minutes (hydrolysis in plasma)
  • Source: Endothelial cells (constitutive and induced)

Both agents activate Gs-coupled receptors to elevate intracellular cAMP — the shared downstream mechanism that produces smooth muscle relaxation.

PropertyVIPProstacyclin
Primary receptorVPAC1/VPAC2IP
CouplingGs → cAMPGs → cAMP
Tissue distributionBroad (neural, epithelial, immune)Primarily vascular
Platelet effectsMinimalPotent inhibition
Endothelial effectsVasodilationVasodilation + antithrombotic
Half-life1–2 min (native)2–3 min
Stable analoguesYes (vasoactive intestinal peptide analogue)Yes (epoprostenol, iloprost, treprostinil)

VIP activates two receptor subtypes with distinct tissue distributions:

  • VPAC1: Widely expressed (lungs, liver, brain, immune cells) — mediates metabolic, secretory, and immune effects.
  • VPAC2: Restricted expression (pancreas, smooth muscle, immune cells) — mediates vasodilation and bronchodilation.

Prostacyclin’s IP receptor is primarily expressed on:

  • Vascular smooth muscle: Vasodilation through cAMP-mediated relaxation.
  • Platelets: Inhibition of platelet aggregation through cAMP elevation in platelets.
  • Endothelial cells: Autocrine/paracrine signaling for vascular homeostasis.

VIP produces vasodilation through multiple mechanisms:

  1. Direct smooth muscle relaxation: VPAC2 activation on vascular smooth muscle → cAMP → PKA → MLCK inhibition → relaxation.
  2. Endothelial NO release: VIP stimulates endothelial nitric oxide synthase (eNOS) → NO production → paracrine vasodilation.
  3. Neural modulation: VIP co-released with NO from NANC nerves provides neurogenic vasodilation.
  4. Tissue-specific effects: VIP-mediated vasodilation is prominent in pulmonary, splanchnic, and cerebral vascular beds.

Prostacyclin produces vasodilation through:

  1. IP receptor activation: IP → Gs → adenylyl cyclase → cAMP → PKA → smooth muscle relaxation.
  2. Platelet inhibition: cAMP elevation in platelets inhibits aggregation → reduced thromboxane A₂ production → reduced vasoconstriction.
  3. Endothelial protection: Prostacyclin inhibits endothelin-1 production → reduced vasoconstrictor tone.
  4. Anti-inflammatory effects: IP activation inhibits leukocyte adhesion and cytokine production.

Both VIP and prostacyclin have been studied for pulmonary arterial hypertension (PAH):

AgentPAH EvidenceRegulatory Status
Epoprostenol (PGI₂)Landmark trials (Badesch 1996)FDA-approved (1995)
Iloprost (PGI₂ analogue)AIR trialFDA-approved (2004)
Treprostinil (PGI₂ analogue)Multiple trialsFDA-approved (2002)
VIP (vasoactive intestinal peptide)Phase II (small studies)Not approved

Prostacyclin is the cornerstone of PAH therapy, with epoprostenol (Flolan) being the first FDA-approved agent to improve survival in PAH. The prostacyclin pathway remains central to PAH treatment guidelines.

VIP has shown promising hemodynamic effects in small PAH studies — reducing pulmonary vascular resistance and improving cardiac output — but lacks the large-scale trial evidence needed for regulatory approval.

ApplicationVIPProstacyclin
Erectile dysfunctionInvestigationalNot applicable
Peripheral vascular diseaseLimited dataApproved (iloprost)
Raynaud’s phenomenonLimited dataApproved (iloprost, treprostinil)
Systemic sclerosisLimited dataApproved (iloprost)
Organ transplant preservationInvestigationalNot applicable
Pulmonary fibrosisUnder investigationNot applicable
EffectVIPProstacyclin
Flushing15–30%20–40%
Headache10–20%30–50%
Hypotension10–20%15–25%
Nausea5–10%15–25%
Jaw painUncommonCommon (epoprostenol)
Diarrhea5–15%10–20%
ThrombocytopeniaNone10–20% (epoprostenol)
Catheter infectionsN/A (SC/IV)Common (continuous IV)

Prostacyclin’s continuous IV infusion (epoprostenol) requires a central venous catheter — a significant infection and thrombosis risk. VIP can be administered subcutaneously, avoiding this complication.

ParameterVIPProstacyclin
Half-life1–2 min2–3 min
RouteSC, IV, inhaledIV (epoprostenol), inhaled, SC, oral
Continuous infusion requiredOftenYes (epoprostenol)
StabilityAcid-stableUnstable (hydrolysis)
formulation complexityModerateHigh (epoprostenol requires alkaline buffer)

Prostacyclin’s instability and short half-life require continuous IV infusion with alkaline buffering — a significant practical limitation. VIP’s greater stability allows more flexible dosing.

VIP and prostacyclin share the downstream cAMP-mediated vasodilation mechanism but differ fundamentally in receptor pharmacology, tissue distribution, and clinical evidence. Prostacyclin has the established clinical evidence base for PAH, with FDA-approved formulations and demonstrated survival benefit. VIP offers a complementary vasodilatory mechanism with potentially broader tissue effects and easier administration, but lacks the large-scale trial evidence for regulatory approval. The choice depends on clinical context: prostacyclin for established PAH therapy with robust evidence, VIP for investigational applications where its broader receptor profile and easier administration may offer advantages.